PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000557836
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 69aa    MW: 7970.27 Da    PI: 5.6491
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000557836genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.91.5e-171863248
            NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                   +pGfrFhPtdeelv +yLk+k+ +k+l++ +vi+e+d+yk++P +Lp
  MDP0000557836 18 APGFRFHPTDEELVLYYLKRKICKKRLKI-NVIAETDVYKWDPYELP 63
                   69***************************.99**************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-191166IPR003441NAC domain
PROSITE profilePS5100519.2361768IPR003441NAC domain
PfamPF023652.5E-81951IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MVTEDDSAAL FCDGHFAAPG FRFHPTDEEL VLYYLKRKIC KKRLKINVIA ETDVYKWDPY  60
ELPGMIFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-1319631761Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13544KRKICKKRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008381037.16e-38PREDICTED: uncharacterized protein LOC103443912
SwissprotQ9XIC51e-25NAC17_ARATH; NAC domain-containing protein 17
TrEMBLM5W6F51e-31M5W6F5_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s06210.12e-23(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.13e-14NAC domain containing protein 17